Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Protein Report: AF475098_1.AA

[Submit comment/correction]

Protein	AF475098_1.AA
Peptide	GRVLIRQRHIRVGRQIVNVPSFMVRVESEKHIDFSLTSPFGGGPAGRVKR KNQKKASGGGDAGGDEEEE

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.