Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AM050675_1.cds

[Submit comment/correction]

Sequence	AM050675_1.cds
Peptide	AGQEAFRSITKSYYRSAAAALLVYDITRRETFNHVASWLEEMREQADGNN NITIMLVGNKSDLGQRRAVSTEEGEQFAKENGLAFMETSARTRHNVEEAF LQSSSNVYEKIQEGAIDLSKVGVSA
Structure From Source	AM050675
Source Exons	1 83 180 390 474 557
Corresponding Protein	AM050675_1.protseq
Gene Product	rab2-like protein
Remark	DB_xref: GI:86439714 Feature: CDS: protein_id = 'CAJ19362.1' Gene: rlp-1B
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.