Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AM050679_1.cds

[Submit comment/correction]

Sequence	AM050679_1.cds
Peptide	LVKLLDSRPRSSRNTHSYMCVKSLVGLDAYKKAGMVRTRKRKEGWKLKKW EAWEHDRFKIEELWRSGHRIQQRMHDSPHRRLNWVRVTDMLESHVDSLDA PWKVWWEVFFE
Structure From Source	AM050679
Source Exons	1 108 399 623
Corresponding Protein	AM050679_1.protseq
Gene Product	FIMBRIATA-like protein
Remark	DB_xref: GI:86439726 Feature: CDS: protein_id = 'CAJ75643.1'; On complementary strand. Gene: fim-1B
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.