Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AM050679_3.cds

[Submit comment/correction]

Sequence	AM050679_3.cds
Peptide	MWHTEPGQFYGLRAEMSIWASPNLETSQESGASLQIYCQDGGHYNLIQVG FHISPSLYHNRDIRFFTYWTKDLKSKGCYNSQCTGYVPASGAKLVPGQAI APPSVYGIQDHYMRISINKVQHSS
Structure From Source	AM050679
Source Exons	1 156 236 289 438 602
Corresponding Protein	AM050679_3.protseq
Gene Product	putative peptidase
Remark	DB_xref: GI:86439728 Feature: CDS: protein_id = 'CAJ19343.1' Gene: pep-1B
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.