Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: D50641_1.cds

Sequence	D50641_1.cds
Peptide	MSCSCGSSCGCGSNCNCGKMYPDLEEKSGATMQVTVIVLGVGSAKVQFEE AAESGEAAHGCSCGANCKCNPCNC
Structure From Source	D50641
Source Exons	1 53 129 300
Corresponding Protein	D50641_1.protseq
Gene	Ids1
Gene Product	metallothionein-like protein plant metallothionein-like protein
Remark	CDS note: plant metallothionein-like protein DB_xref: GI:2647938 Feature: CDS: protein_id = 'BAA23628.1'; Gene: Ids1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.