Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: DQ097959_1.cds

Sequence	DQ097959_1.cds
Peptide	AGEIPSSIGDCQSLEYLNTSGNYLGGKIPQSLDRLTGLLMLNLSHHNLSG SIPKFLGTMKGLATLDLSSNN
Structure From Source	DQ097959
Source Exons	1 215
Corresponding Protein	DQ097959_1.protseq
Gene Product	LRR protein kinase
Remark	DB_xref: GI:70727917 Feature: CDS: protein_id = 'AAZ07987.1'
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.