Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: DQ145554S2_1.cds

Sequence	DQ145554S2_1.cds
Peptide	REQCNIDGHKSSSKHADLNPHANDSVLGIILGGGAGTRLYPLTKKRAKPA VPLGANYRLI
Structure From Source	DQ145554S2
Source Exons	1 74 1161 1269
Corresponding Protein	DQ145554S2_1.protseq
Gene Product	ADP-glucose pyrophosphorylase small subunit
Remark	CDS note: alternatively spliced DB_xref: GI:84993803 Feature: CDS: protein_id = 'ABC68321.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.