Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: DQ145554S2_2.cds

Sequence	DQ145554S2_2.cds
Peptide	RAVSDSKSSQTCLDPDASTSVLGIILGGGAGTRLYPLTKKRAKPAVPLGA NYRLI
Structure From Source	DQ145554S2
Source Exons	1 58 1161 1269
Corresponding Protein	DQ145554S2_2.protseq
Gene Product	ADP-glucose pyrophosphorylase small subunit
Remark	CDS note: alternatively spliced DB_xref: GI:84993805 Feature: CDS: protein_id = 'ABC68323.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.