Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: DQ154920_1.cds

Sequence	DQ154920_1.cds
Peptide	GAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKKWALPA AT
Structure From Source	DQ154920
Source Exons	1 20 99 237
Corresponding Protein	DQ154920_1.protseq
Gene Product	delta-1-pyrroline-5-carboxylate dehydrogenase
Remark	DB_xref: GI:73913063 Feature: CDS: protein_id = 'AAZ91470.1' Gene: P5CDH
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.