Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF077438_1.cds

Sequence	EF077438_1.cds
Peptide	SGPWSWCDPATGYKVSTLTGCRAMVKLQCVGSQVPEAVLRDCCQQLADIN NEWCRCGDLSSMLRSVYQELGVREGKEVLPGCLKEVMKLTAASVPEVCKV PIPNPSGDRAGVCYWAAYPDV
Structure From Source	EF077438
Source Exons	1 366
Corresponding Protein	EF077438_1.protseq
Gene Product	monomeric alpha-amylase inhibitor
Remark	DB_xref: GI:134034571 Feature: CDS: protein_id = 'ABO45966.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.