Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF095107_1.cds

Sequence	EF095107_1.cds
Peptide	ELMRVRFSKTRFGEHQAENWWKENREKVYERYNVRTSQRASSAASTHSA
Structure From Source	EF095107
Source Exons	1 24 414 540
Corresponding Protein	EF095107_1.protseq
Gene	11B
Gene Product	11B protein
Remark	DB_xref: GI:126702127 Feature: CDS: protein_id = 'ABO26767.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.