Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF108656_1.cds

Sequence	EF108656_1.cds
Peptide	LHPVPVAIGGPGLHPGVRFRSDIQTPGLANVAATVMNLHGFQAPADYETT LIEVVDK
Structure From Source	EF108656
Source Exons	1 10 105 269
Corresponding Protein	EF108656_1.protseq
Gene	Bp3B
Gene Product	Bp3B protein
Remark	CDS note: involved in ATP biosynthesis; involved in conversion of phosphglycerate C2 to C3 DB_xref: GI:129282309 Feature: CDS: protein_id = 'ABO30146.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.