Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF109032_1.cds

Sequence	EF109032_1.cds
Peptide	MSTYCFIFYSFSDSHSLNFTYTFELPTSVVAFYPASRTLEEEKEEQPKVE EEE
Structure From Source	EF109032
Source Exons	1 111 221 268
Corresponding Protein	EF109032_1.protseq
Gene	HgA
Gene Product	HgA protein
Remark	DB_xref: GI:132449081 Feature: CDS: protein_id = 'ABO33519.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.