Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF109566_1.cds

Sequence	EF109566_1.cds
Peptide	VESQAQDRIHRIGQFKPIRSTRFVIKDTVEERILQLQEKKQLVFDGTVGD SPEAMSKLTEADLKFLFQN
Structure From Source	EF109566
Source Exons	1 58 143 223 309 381
Corresponding Protein	EF109566_1.protseq
Gene	Mp7a
Gene Product	SNF2 family N-terminal domain protein
Remark	DB_xref: GI:129282481 Feature: CDS: protein_id = 'ABO30232.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.