Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF115162_1.cds

Sequence	EF115162_1.cds
Peptide	VYDKARNAVALALSPVVRALVDPDGALQQVRDLDD
Structure From Source	EF115162
Source Exons	1 105
Corresponding Protein	EF115162_1.protseq
Gene	ZdsB
Gene Product	zeta carotene desaturase
Remark	DB_xref: GI:132455468 Feature: CDS: protein_id = 'ABO33801.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.