Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF382962_1.cds

Sequence	EF382962_1.cds
Peptide	SNYTELSQLYPKYKDQGFEILAFPCNQFGGQEPGTNDEIVQFACTRFKAE YPIFDKVDVNGNNVSPLYKFLKSSKGGLFGDSIKWNFSKFLVDKEGHVVD RY
Structure From Source	EF382962
Source Exons	1 51 231 349 527 664
Corresponding Protein	EF382962_1.protseq
Gene	GPX
Gene Product	glutathione peroxidase
Remark	DB_xref: GI:148529492 Feature: CDS: protein_id = 'ABQ82084.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.