Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF382963_1.cds

Sequence	EF382963_1.cds
Peptide	SNYTELSQLYPKYKDQGFEILAFPCNQFGGQEPGTNDEIVQFACTRFKAE YPIFDKVDVNGNNVSPLYKFLKSSKGGLFGDSIKWNFSKFLVDKEGHVVD RY
Structure From Source	EF382963
Source Exons	1 51 230 348 526 663
Corresponding Protein	EF382963_1.protseq
Gene	GPX
Gene Product	glutathione peroxidase
Remark	DB_xref: GI:148529494 Feature: CDS: protein_id = 'ABQ82085.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.