Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF382964_1.cds

Sequence	EF382964_1.cds
Peptide	SNYTELSQLYPKYKDQGFEILAFPCNQFGGQEPGTNDEIVQFACTRFKAE YPIFDKVDVNGNNVSPLYKFLKSSKGGLFGDSIKWNFSKFLVDKEGHVVD RY
Structure From Source	EF382964
Source Exons	1 51 230 348 524 661
Corresponding Protein	EF382964_1.protseq
Gene	GPX
Gene Product	glutathione peroxidase
Remark	DB_xref: GI:148529496 Feature: CDS: protein_id = 'ABQ82086.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.