Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF428115_1.cds

Sequence	EF428115_1.cds
Peptide	RVTFGNRTVSNGCELKPSMVAQQPRVEVGGNEMRTFYTLVMVDPDAPSPS DPNLREYLHWLVTDIPGTTGASFGQEVMCYESPRPTMGIHRFVLVLF
Structure From Source	EF428115
Source Exons	1 119 511 572 681 793
Corresponding Protein	EF428115_1.protseq
Gene	FTA
Gene Product	FT protein
Remark	DB_xref: GI:126513247 Feature: CDS: allele = 'h1'; protein_id = 'ABO15729.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.