Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF428117_1.cds

Sequence	EF428117_1.cds
Peptide	RVTFGNRTVSNGCELKPSMVAQQPRVEVGGNEMRTFYTLVMVDPDAPSPS DPNLREYLHWLVTDIPGTTGASFGQEVMCYESPRPTMGIHRFVLVLF
Structure From Source	EF428117
Source Exons	1 119 511 572 679 791
Corresponding Protein	EF428117_1.protseq
Gene	FTA
Gene Product	FT protein
Remark	DB_xref: GI:126513251 Feature: CDS: allele = 'h3'; protein_id = 'ABO15731.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.