Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF601535_1.cds

Sequence	EF601535_1.cds
Peptide	WGMKYFWDTLLDADLESDALGWQYISGSLPDGRELDRIDNPQFEGYKFDP YGEYVRRWLPELARLPTEWIHHPWDA
Structure From Source	EF601535
Source Exons	1 126 233 333
Corresponding Protein	EF601535_1.protseq
Gene	Cry1a
Gene Product	cryptochrome 1a
Remark	DB_xref: GI:161138106 Feature: CDS: protein_id = 'ABX58025.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.