Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF679526_1.cds

[Submit comment/correction]

Sequence	EF679526_1.cds
Peptide	MCKAGFAGDDAPRAVFPSIVGRPRHHGIMIGMGQKDS
Structure From Source	EF679526
Source Exons	1 49 111 141 200 232
Corresponding Protein	EF679526_1.protseq
Gene	act
Gene Product	actin
Remark	DB_xref: GI:157276918 Feature: CDS: protein_id = 'ABV28952.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.