Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AAHF01000014_15.cds

[Submit comment/correction]

Sequence	AAHF01000014_15.cds
Peptide	MAPRSVVSISYCEFGGTAKKCEEWLKDNHAELYQRLYSEEALSSNLSELS VSVRERAAKDAAKKEAKAAAAEARDAERKAAAKVQIKRVERNKRKHVTVI TGLEVHGLENKKVAKELGKKFATGSSVTKSPAGVEEITVQGDVSEDVKEW LLELYGKEIPESNIELVEDKKKKTSG
Structure From Source	AAHF01000014
Source Exons	1 413 479 566 908 937
Corresponding Protein	AAHF01000014_15.protseq
Gene Product	Density-regulated protein, putative
Remark	CDS note: go_component: cytoplasm [goid 0005737]; go_function: RNA binding [goid 0003723] DB_xref: GI:66844559 Feature: CDS: locus_tag = 'Afu8g02730'; protein_id = 'EAL84896.1'; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.