Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AAHF01000014_33.cds

Sequence	AAHF01000014_33.cds
Peptide	MGMSGRELIEAKDKWEKLAMGARPFHVVCDSIEALEDRSRDGDILGGWAG GGTMVVAWLGLGWGLAGKLECNLTAWLSENRPMNRGTGYQTIRGLAACQ
Structure From Source	AAHF01000014
Source Exons	1 143 211 367
Corresponding Protein	AAHF01000014_33.protseq
Gene Product	hypothetical protein
Remark	DB_xref: GI:66844577 Feature: CDS: locus_tag = 'Afu8g02540'; protein_id = 'EAL84914.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.