Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY082965_1.cds

[Submit comment/correction]

Sequence	AY082965_1.cds
Peptide	REAKLMRYKEKRKRRRYEKQIRYASRKAYAEMRPRVKGRFAKVPDGGEGA APSPPQQPTQAAGYEPSRLDLGWFRS
Structure From Source	AY082965
Source Exons	1 231
Corresponding Protein	AY082965_1.protseq
Gene Product	CONSTANS-like protein CO9
Remark	CDS note: HvCO9 DB_xref: GI:21655162 Feature: CDS: protein_id = 'AAL99271.1'; Gene: CO9
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.