Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY090647_1.cds

[Submit comment/correction]

Sequence	AY090647_1.cds
Peptide	FISLLLIVTQDPIIAKICISEDAADVMWPCKRGTEGRKPSKYVDYCPEGK VALMSTGSLHQLHVFIFVLAVFHVTYS
Structure From Source	AY090647
Source Exons	1 144 269 355
Corresponding Protein	AY090647_1.protseq
Gene Product	Mlo protein
Remark	DB_xref: GI:20258626 Feature: CDS: protein_id = 'AAM14414.1'; Gene: Mlo
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.