Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY223807_3.cds

[Submit comment/correction]

Sequence	AY223807_3.cds
Peptide	MTVDRKGAQAAAAAAATSAPFEIPALQPGRTCGAEESTRSHVLVEPIGKS DLGGHVMALIPSLRRSSDGKK
Structure From Source	AY223807
Source Exons	1 89 1168 1220 2049 2122
Corresponding Protein	AY223807_3.protseq
Gene Product	AP2 transcriptional activator DRF1.2
Remark	CDS note: HvDRF1.2; alternatively spliced; variant 2 DB_xref: GI:30313899 Feature: CDS: protein_id = 'AAO38210.1'; Gene: DRF1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.