Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AAHF01000014_188.cds

[Submit comment/correction]

Sequence	AAHF01000014_188.cds
Peptide	MNLLDLPTEVLVMIAEALQTAHDINTLARTSRTLYSCINYVLYQSDVQNG NGKALIWAARRNKPATAQKSLQAGVKKLKKMASPAPDALVKGRPRSHDAV VIGRRC
Structure From Source	AAHF01000014
Source Exons	1 321
Corresponding Protein	AAHF01000014_188.protseq
Gene Product	F-box domain protein
Remark	DB_xref: GI:66844732 Feature: CDS: locus_tag = 'Afu8g00990'; protein_id = 'EAL85069.1'; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.