Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY247214_1.cds

[Submit comment/correction]

Sequence	AY247214_1.cds
Peptide	EQVDKLTLHIDIAGKINRCIREFGLRDLGQLEQDLVFGDAGAKEVINMLR SKQNLSEENKLRLLIIYAIVCPE
Structure From Source	AY247214
Source Exons	1 33 342 467 542 603
Corresponding Protein	AY247214_1.protseq
Gene Product	Sec1p-like protein 2
Remark	DB_xref: GI:32308086 Feature: CDS: protein_id = 'AAP79423.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.