Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AAHF01000014_253.cds

Sequence	AAHF01000014_253.cds
Peptide	MHNQPLSQEYYQFTRFLQELENRRRQYTTNQPPVVKTYATTAKPTQHSQS P
Structure From Source	AAHF01000014
Source Exons	1 156
Corresponding Protein	AAHF01000014_253.protseq
Gene Product	hypothetical protein
Remark	DB_xref: GI:66844797 Feature: CDS: locus_tag = 'Afu8g00320'; protein_id = 'EAL85134.1'; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.