Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY485644_8.cds

Sequence	AY485644_8.cds
Peptide	MHYVARRRCATRRHRSDGGDELQTTGFKGVSGWDPFEEDNLTLRRFLRTR GHNIGKASAMLLKYLAWKRAVKPRGFISDDEVHNQLAQEKVYTQGFDKMG RPMVYLFAARHFPRRDFDELKRYVVYQEKFAAVVDLKGWGYVNCDIKASV AGLDIIKNYYPEQLGQVFLVHVPFVFMAAWKLGCTFVDNNTKKKFVFIDD RDLSGTLRDVVDESQLPDVYGGKFKLQGYNHSSPPSSTCN
Structure From Source	AY485644
Source Exons	1 108 944 1213 1371 1715
Corresponding Protein	AY485644_8.protseq
Gene Product	phosphatidylinositol phosphatidylcholine transfer protein sec14 cytosolic-like protein
Remark	CDS note: exon 2 may extend to next GC splicing site based on alignment with putative rice orthologue AAO20076.1 and putative paralogous wheat EST BJ227676. This alternative annotation would result in the addition of amino acids VLDKTC to the second exon (rice: VLDRT) DB_xref: GI:45357057 Feature: CDS: locus_tag = 'Tm_AY485644.7'; /protein_id = 'AAS58485.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.