Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY533100_1.cds

Sequence	AY533100_1.cds
Peptide	APGTKITFHVEKGSNPNYLAVLVKFVSDDGDVVQMDIQESKSPAWIPLTL SWGAIWRWDGAKPLKGPFSIRVTSESGKKLIAKDVIPANWKADTVYTSNV QF
Structure From Source	AY533100
Source Exons	1 311
Corresponding Protein	AY533100_1.protseq
Gene Product	beta-expansin 1
Remark	CDS note: TaEXPB1; specifically expressed in developing male gametophyte, not in mature pollen DB_xref: GI:42601003 Feature: CDS: protein_id = 'AAS21273.1'; Gene: EXPB1
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.