Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY544173_1.cds

Sequence	AY544173_1.cds
Peptide	DVVFKSGKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKIDAT ANDVPGEFDVQGYPTLYFVTPSGKKV
Structure From Source	AY544173
Source Exons	1 28 173 285 371 458
DB Remark	5.3.4.1
Corresponding Protein	AY544173_1.protseq
Gene Product	protein disulfide isomerase
Remark	CDS note: foldase DB_xref: GI:47118055 Feature: CDS: protein_id = 'AAT11166.1' Gene: PDI4A
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.