Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY544175_1.cds

Sequence	AY544175_1.cds
Peptide	VVTFDKNPDNHPYLLKFFQSNAPKAMLFLNFSTGPFESFKKAYYGAVEEF
Structure From Source	AY544175
Source Exons	1 72 747 824
DB Remark	5.3.4.1
Corresponding Protein	AY544175_1.protseq
Gene Product	protein disulfide isomerase
Remark	CDS note: foldase DB_xref: GI:47118061 Feature: CDS: protein_id = 'AAT11168.1' Gene: PDI4B
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.