Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY548406_1.cds

Sequence	AY548406_1.cds
Peptide	DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHS RIRNCLVQLYSKDITPDDKQELDEALHREIQAAFRTDEIRRTQPTPQDEM RAGMSYFHETIWKGVPKFLRRVDT
Structure From Source	AY548406
Source Exons	1 153 239 323 462 595
Corresponding Protein	AY548406_1.protseq
Gene Product	phosphoenolpyruvate carboxylase
Remark	DB_xref: GI:56785816 Feature: CDS: protein_id = 'AAW29043.1' Gene: pepC
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.