Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY548408_1.cds

Sequence	AY548408_1.cds
Peptide	LKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNC LVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMS YFHETIWKGVPKFLRRVDT
Structure From Source	AY548408
Source Exons	1 137 223 307 446 579
Corresponding Protein	AY548408_1.protseq
Gene Product	phosphoenolpyruvate carboxylase
Remark	DB_xref: GI:56785820 Feature: CDS: protein_id = 'AAW29045.1' Gene: pepC
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.