Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY548412_1.cds

Sequence	AY548412_1.cds
Peptide	KRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCL VQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSY FHETIWKGVPKFLRRVDT
Structure From Source	AY548412
Source Exons	1 134 216 300 440 573
Corresponding Protein	AY548412_1.protseq
Gene Product	phosphoenolpyruvate carboxylase
Remark	DB_xref: GI:56785827 Feature: CDS: protein_id = 'AAW29048.1' Gene: pepC
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.