Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY549888_1.cds

Sequence	AY549888_1.cds
Peptide	MKSTKLAAILILQAVLVMGILSHVNADFFPKCCNNCRSFSGVDVCDDAHP QCPKGCSACRVVTPSPHKTFRCADMKSTVDGTCGGPCKKH
Structure From Source	AY549888
Source Exons	1 273
Corresponding Protein	AY549888_1.protseq
Gene Product	putative proteinase inhibitor-related protein
Remark	DB_xref: GI:44975655 [ Show all 6 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.