Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY639690_1.cds

Sequence	AY639690_1.cds
Peptide	IPMDDPTLISRQQLFARIVGGLGGRAAEEIIFGDSEVTTGAAGDLQQITG LAKQMVVTFGMSDIGPWSLMDAAQSGDVIMR
Structure From Source	AY639690
Source Exons	1 164 255 337
Corresponding Protein	AY639690_1.protseq
Gene Product	FtsH-like protein
Remark	DB_xref: GI:49246311 Feature: CDS: protein_id = 'AAT58287.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.