Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY639704_1.cds

Sequence	AY639704_1.cds
Peptide	LNQLLTEMDGFEGNTGIIVVAATNRADILDSALLRPGRFDRQV
Structure From Source	AY639704
Source Exons	1 130
Corresponding Protein	AY639704_1.protseq
Gene Product	FtsH-like protein
Remark	DB_xref: GI:49246339 Feature: CDS: protein_id = 'AAT58301.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.