Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY643843_4.cds

Sequence	AY643843_4.cds
Peptide	MKTLFLLAILALVASTTFAQYSVGGGYNDVGGGGGSQQCPQERPNLGSCK DYVMERCFTMKDFPLTWPTKWWKGGCEQEVREKCCQQLSQIAPQCRCDAI RGVIQGKLGGIFGIGGGDVFKQIQRAQILPSKCNMGADCKFPSGYYW
Structure From Source	AY643843
Source Exons	1 444
Corresponding Protein	AY643843_4.protseq
Gene Product	hordoindoline b-1
Remark	DB_xref: GI:55276714 Feature: CDS: protein_id = 'AAV49986.1'; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.