Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU008510_1.cds

Sequence	EU008510_1.cds
Peptide	TGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITI DIALWKFETPRYYVTVI
Structure From Source	EU008510
Source Exons	1 63 301 439
Corresponding Protein	EU008510_1.protseq
Gene Product	translation elongation factor-1 alpha
Remark	DB_xref: GI:166165360 Feature: CDS: protein_id = 'ABY84024.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.