Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU146230_1.cds

[Submit comment/correction]

Sequence	EU146230_1.cds
Peptide	TVVVVMEFTVGATLSKGLNRAMATLVAGCIAVGAHQLAELAERCSDQGEP VMLTVLVFFVASAATFLRFIPEIKAKYDYG
Structure From Source	EU146230
Source Exons	1 32 167 316 434 492
Corresponding Protein	EU146230_1.protseq
Gene Product	ALMT1-M39.2
Remark	CDS note: Almt1-like protein; ScALMT1-M39.2 DB_xref: GI:164414916 Feature: CDS: protein_id = 'ABY52946.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.