Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU146232_1.cds

Sequence	EU146232_1.cds
Peptide	TVVVVMEFTVGATLSKGLNRALATLVAGCIAVGAHQLAELAERCSDQGEP VMLTVLVFFVASAATFLRFIPEIKAKYDYG
Structure From Source	EU146232
Source Exons	1 32 171 320 433 491
Corresponding Protein	EU146232_1.protseq
Gene Product	ALMT1-M39.4
Remark	CDS note: Almt1-like protein; ScALMT1-M39.4 DB_xref: GI:164414920 Feature: CDS: protein_id = 'ABY52948.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.