Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU146235_1.cds

Sequence	EU146235_1.cds
Peptide	TVVVVMEFTVGATLSKGLNRALATLVAGCIAVGAHQLAELAERCSDQGEP VMLTVLVFFVASAATFLRFIPEIKAKYDYG
Structure From Source	EU146235
Source Exons	1 32 170 319 428 486
Corresponding Protein	EU146235_1.protseq
Gene Product	ALMT1-M77.2
Remark	CDS note: Almt1-like protein; ScALMT1-M77.2 DB_xref: GI:164414926 Feature: CDS: protein_id = 'ABY52951.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.