Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU177565_1.cds

Sequence	EU177565_1.cds
Peptide	VLVYTVFSATDPKRTARDAFVPLVAALPIGLAVFVVHLATIPITGTGINP ARSLGAAVLYNQHKTWKQHWIFWVG
Structure From Source	EU177565
Source Exons	1 67 158 298 404 422
Corresponding Protein	EU177565_1.protseq
Gene	PIP2-12
Gene Product	aquaporin
Remark	CDS note: TaPIP2;12 DB_xref: GI:161897644 Feature: CDS: protein_id = 'ABX79968.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.