Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU197052_3.cds

Sequence	EU197052_3.cds
Peptide	MTVDRKHAEAAAAAPFEIPALQPGRTCGAEESTRSHVLVKPIGKSDLGDH VMGLIQSLKRSGDGKK
Structure From Source	EU197052
Source Exons	1 74 1002 1054 2032 2105
Corresponding Protein	EU197052_3.protseq
Gene	DRF1
Gene Product	DRF1.2
Remark	CDS note: AP2 transcriptional activator; truncated form lacking AP2 domain due to frameshift and premature stop codon; alternatively spliced DB_xref: GI:164665403 Feature: CDS: protein_id = 'ABY66037.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.