Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU283104_1.cds

Sequence	EU283104_1.cds
Peptide	EKQKAHTQQAQWEQTHPQTSSSSSSFMIREAPPATNIAGNQPAAAGERSE EAAAQPQARSGLPPWM
Structure From Source	EU283104
Source Exons	1 111 287 373
Corresponding Protein	EU283104_1.protseq
Gene Product	VRN1B
Remark	DB_xref: GI:161898527 Feature: CDS: protein_id = 'ABX80296.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.