Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU293131_1.cds

[Submit comment/correction]

Sequence	EU293131_1.cds
Peptide	MRPQVLLAALAVIAVLAAALPLAHSQGATLCCDNCGSCTRSIPPQCTCMD TSPTGCNPACKTCSRSTVGGRNSFQCKDRVANFCKTRCTNAA
Structure From Source	EU293131
Source Exons	1 279
Corresponding Protein	EU293131_1.protseq
Gene Product	Bowman-Birk trypsin inhibitor-like protein
Remark	DB_xref: GI:162319712 Feature: CDS: protein_id = 'ABX84382.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.