Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU325680_4.cds

Sequence	EU325680_4.cds
Peptide	MVKLRLKRCGRKQQAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTSLNV PAILYFLEKGAQPTRTVYDILKKAEFFKEKERTLS
Structure From Source	EU325680
Source Exons	1 218 1044 1083
Corresponding Protein	EU325680_4.protseq
Gene	rps16
Gene Product	ribosomal protein S16
Remark	DB_xref: GI:193075540 Feature: CDS: transl_table = 11; protein_id = 'ACF08623.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.